7B6RC

Drosophila melanogaster trappiii partial complex: core plus c8 and c11 attached region
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
165
structure length
165
Chain Sequence
AKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLARTSAPRCLEMRETADRIQQAFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFVELPPDLTNLRYSAILSGCIRGALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEEVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of metazoan TRAPPIII, the multi-subunit complex that activates the GTPase Rab1
doi rcsb
molecule keywords FI18195p1
molecule tags Exocytosis
source organism Drosophila melanogaster
total genus 38
structure length 165
sequence length 165
chains with identical sequence I
ec nomenclature
pdb deposition date 2020-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04051 TRAPP Transport protein particle (TRAPP) component
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...