7B6YA

C8(355-600) from the minitrappiii complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
246
structure length
208
Chain Sequence
DNLRHFVQDYAVRALIPYIEHLVAILAEGVTAELQTRKLGDLYFMFGHYNLAFQSYHQAKRDFNADSAWQYYAGALEMAALSAFMLGTAQRKTYDYMEDAIVCYLTVCKLQQFATRATLLSMECLKTARLYSEVAKQLIRMTNEESDLRSALLLEQAAYCFLVTQPPMHRKYAFHIVLAGNRYSRAGQRKHAYRCYRQAYQVFQKREW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the metazoan TRAPP complexes that activate Rab1 and Rab11.
rcsb
molecule keywords FI18195p1
molecule tags Exocytosis
source organism Drosophila melanogaster
total genus 74
structure length 208
sequence length 246
ec nomenclature
pdb deposition date 2020-12-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...