7B74AAA

Chimeric streptavidin with a dimerization domain for artificial transfer hydrogenation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
157
structure length
122
Chain Sequence
DQAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGAAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTAGTTEANAWKSTLVGHDTFTKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spiers Memorial Lecture: Shielding the active site: a streptavidin superoxide-dismutase chimera as a host protein for asymmetric transfer hydrogenation.
pubmed doi rcsb
molecule keywords Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin
molecule tags Metal binding protein
source organism Streptomyces avidinii
total genus 26
structure length 122
sequence length 157
chains with identical sequence BBB, CCC, DDD
ec nomenclature ec 1.15.1.1: superoxide dismutase.
pdb deposition date 2020-12-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...