7BC3B

Native virion of kashmir bee virus at acidic ph
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
249
structure length
248
Chain Sequence
NVHNTKLASTSAENAIEKEQITTFHDVETPNRIDTPMAQDTSSARSMDDTHSIIQFLQRPVLIDNIEIVAGTTADNNTALSRYVLDRTNPQKYIKQWTLPSTVLKAGGKAQKLANFKYLRCDVQVKLVLNANPFIAGRLYLAYSPYDDKVAPERRIIYTSRAGVTGYPGVELDFQLDNSVEMTIPYASFQEAYDLVSGNEDFVQLYLFTIAPVLGPSASANSKVDLSVYMWLDNISLVIPTYRLNPNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Virion structure and in vitro genome release mechanism of dicistrovirus Kashmir bee virus.
pubmed doi rcsb
molecule keywords Structural polyprotein
molecule tags Virus
total genus 44
structure length 248
sequence length 249
ec nomenclature
pdb deposition date 2020-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...