7BEIE

Crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in complex with covox-150 fab
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
194
structure length
194
Chain Sequence
NLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The antigenic anatomy of SARS-CoV-2 receptor binding domain
doi rcsb
molecule tags Viral protein/immune system
source organism Homo sapiens
molecule keywords COVOX-150 heavy chain
total genus 45
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2020-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09408 bCoV_S1_RBD Betacoronavirus spike glycoprotein S1, receptor binding
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...