7BHGA

Gene-engineered variant of fusionred with trp based chromophore - 2.1a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
223
structure length
222
Chain Sequence
ELIKENMPTKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFSRTFIKHPPGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKVRGVNFPSNGPVMQKKTLGWEASTETMYPADGGLEGRCDMALKLVGGGHLICNLKTTYRSKKPATKLKMPGVYYVDHRLERIKEADDETYVEQHEVAVARYCDLPSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Fluorescent protein FP480
publication title Gene-engineered variant of FusionRed with Trp based chromophore - 2.1A
rcsb
source organism Entacmaea quadricolor
total genus 64
structure length 222
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-01-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...