7BIUA

Xfel crystal structure of cytochrome c peroxidase compound ii
Total Genus 113

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
292
structure length
292
Chain Sequence
PLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTII3 (271-274)S1 (6-7)3H1 (37-39)AH1 (16-33)S2 (179-180)TI1 (33-36)TIV2 (192-195)3H3 (80-82)AH2 (42-55)TI2 (58-61)AH6 (151-161)AH11 (255-271)AH3 (74-78)TI4 (66-69)3H2 (70-72)AH4 (85-98)AH5 (104-119)TIV3 (194-197)TI11 (277-280)TI6 (146-149)AH9 (233-240)AH7 (165-172)AH8 (200-208)3H5 (173-176)TI8 (183-186)S4 (211-215)TI7 (181-184)TI9 (216-219)TI10 (225-228)S3 (189-190)S5 (221-225)S6 (229-231)S7 (274-275)3H6 (289-292)TII2 (82-85)TI5 (99-102)AH10 (242-253)TII1 (11-14)3H4 (135-137)Updating...
connected with : NaN
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title XFEL Crystal Structures of Peroxidase Compound II.
pubmed doi rcsb
molecule keywords Cytochrome c peroxidase, mitochondrial
total genus 113
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2021-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.