7BL4W

In vitro reconstituted 50s-obge-gmppnp-rsfs particle
Total Genus 13

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
TRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTII2 (28-31)O1 (15-17)TVIII1 (19-22)S1 (18-19)S6 (55-57)S2 (25-27)TII1 (22-25)S3 (31-35)TIV1 (36-39)TI2 (69-72)TVIII2 (39-42)S8 (73-80)TI1 (50-53)S4 (42-43)TII3 (44-47)S5 (47-49)S7 (61-68)Updating...
connected with : NaN
molecule tags Ribosome
publication title Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L36
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2021-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.