7BNXA

Archeal holliday junction resolvase from thermus thermophilus phage 15-6
Total Genus 32

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
145
structure length
122
Chain Sequence
KGRRYENELVELLKQRGFTAWRVPSDVRVMLAGQEHRVEVKMRSTPQAASATRILSKLPFSCQGYRVFFLECKLPKNWVRWLNGAHILAVRLPKRFTSPYGGLTGWIIVLPDTLWDAWRSEM

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (6-20)AH2 (104-109)TIV1 (27-40)S1 (23-26)S2 (41-45)EMPTYS3 (48-56)3H1 (60-63)S4 (74-76)TIV6 (109-112)TI1 (65-68)TIV3 (67-70)TI3 (68-71)TIV5 (75-78)S5 (79-83)S6 (114-118)AH3 (121-124)TIV2 (44-47)Updating...
connected with : NaN
molecule tags Recombination
source organism Thermus thermophilus phage 15-6
publication title Crystal structure and initial characterization of a novel archaeal-like Holliday junction-resolving enzyme from Thermus thermophilus phage Tth15-6.
pubmed doi rcsb
molecule keywords Holliday junction resolvase
total genus 32
structure length 122
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-01-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.