7BOFQ

Bacterial 30s ribosomal subunit assembly complex state i (body domain)
Total Genus 11

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
80
Chain Sequence
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS4 (57-63)TII3 (54-57)S1 (8-17)S2 (20-30)S3 (37-47)TII1 (17-20)TI1 (32-35)TII2 (48-51)S5 (73-80)TI2 (68-71)TIV1 (31-34)Updating...
connected with : NaN
molecule tags Ribosome
publication title A conserved rRNA switch is central to decoding site maturation on the small ribosomal subunit.
pubmed doi rcsb
molecule keywords 16S rRNA
total genus 11
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2021-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.