7C2KC

Covid-19 rna-dependent rna polymerase pre-translocated catalytic complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
73
structure length
73
Chain Sequence
PSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for RNA Replication by the SARS-CoV-2 Polymerase.
pubmed doi rcsb
molecule tags Viral protein/rna
source organism Severe acute respiratory syndrome coronavirus 2
molecule keywords RNA-directed RNA polymerase
total genus 24
structure length 73
sequence length 73
ec nomenclature ec 2.1.1.-:
pdb deposition date 2020-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08716 CoV_NSP7 Coronavirus replicase NSP7
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...