7C3OA

Crystal structure of tt109 from candida albicans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
359
structure length
315
Chain Sequence
MLPPDILQNGEFETIYFQTNPTYIKSPIHIPKSTIGKPDTVKIRHFFALLHQDLVVLGLEVFVYLQIYSDFVEKYVYVSKCDTVGLEKSTIKIGKVIGPVLQYIINYNGYKIKMKNIEYRTLPKTQNLRLCVFTKPAKEYLFPNSAKNPYKNLLNGQSLLRWWISIIDSITKGWNNHKLMIPGADKWATRKFIEKYSDWSEGHIFKKDGLAVQAIPLFPDDPGRFLELVIVECRYGKMTVSRFYQELAYRQEFLLGDCVSLIGCCKENLEVTYHDDLVSTVTISEYKEFMNLLKLVDFSDRVEVSNFVSNYRKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TT109 from CANDIDA ALBICANS
rcsb
molecule keywords Histone acetyltransferase RTT109
molecule tags Transferase
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 89
structure length 315
sequence length 359
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2020-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08214 HAT_KAT11 Histone acetylation protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...