7C81C

E30 f-particle in complex with 6c5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
238
structure length
238
Chain Sequence
GLPTMNTPGSTQFLTSDDFQSPSAMPQFDVTPEIQIPGQVRNLMEIAEVDSVVPVNNTEGHVNSMEAYRIPVRPQTSSGEQVFGFQLQPGHDSVLKHTLLGEILNYYANWSGSMKLTFMYCGAAMATGKFLIAYSPPGAGVPGSRRDAMLGTHVIWDVGLQSSCVLCVPWISQTNYRYVTSDAYTDAGYITCWYQTSIVTPPDIPTTSTILCFVSACNDFSVRLLRDTPFITQQALFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serotype specific epitopes identified by neutralizing antibodies underpin immunogenic differences in Enterovirus B.
pubmed doi rcsb
molecule tags Virus/immune system
molecule keywords VP1
total genus 31
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2020-05-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...