7C9WD

E30 f-particle in complex with cd55
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
67
structure length
57
Chain Sequence
GAQVSTQKTGAHIIHYTNINYYKDSASNSLNRQDFTQDPSKFTEPVKDVMIKTLPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Echovirus 30 in complex with its receptors inform a rational prediction for enterovirus receptor usage.
pubmed doi rcsb
molecule keywords VP1
molecule tags Virus
source organism Homo sapiens
total genus 2
structure length 57
sequence length 67
ec nomenclature
pdb deposition date 2020-06-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...