7CAOA

Crystal structure of red chromoprotein from olindias formosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
227
structure length
226
Chain Sequence
MALFAKPMNHKTEITGEFNGKCFKVVGHGSAPGGGDFRMHAYCESGTLPVSWCVLSPSIFSMFTKYPNGITNFFQEAFPEGYTLDRVMTRENGGSVVSHHSYDLGKDGITAKVSVKGEGFDPNGPTMTKGYLKVLPFVCHLYPHGAGVRMTSSVGMVKTDGSLDIFNVDSNYQPVGSRKVSVPKFHFVQHRIILMKDKSDTRDHIVMREIAVAQDPNEAQSAFRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Chromoprotein
publication title Structure-based analysis and evolution of a monomerized red-colored chromoprotein from the Olindias formosa jellyfish.
pubmed doi rcsb
source organism Olindias formosus
total genus 55
structure length 226
sequence length 227
ec nomenclature
pdb deposition date 2020-06-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...