7CCHA

Acinetobacter baumannii histidine kinase ades
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
197
Chain Sequence
AIAHELRTPITILQGRLQGIIDGVFKPDEVLFKSLLNQVEVLSHLVEDLRTLSLVENQQLRLNYELFDFKAVVEKVLKAFEDRLDQAKLVPELDLTSTPVYCDRRRIEQVLIALIDNAIRYSHAGKLKISSEVVSQNWILKIEDEGPGIATEDDLFKPFTGLGLAVVHAIIVALKGTIQYSNQGSKSIFTIKISMNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteolysis and multimerization regulate signaling along the two-component regulatory system AdeRS.
pubmed doi rcsb
molecule tags Signaling protein
source organism Acinetobacter baumannii
molecule keywords AdeS
total genus 55
structure length 197
sequence length 212
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2020-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...