7CFVA

Solution nmr structure of dnax mini intein from spirulina platensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
137
structure length
137
Chain Sequence
EALTGDALILSDRGWLRIDDPTLQECRVLSYNESTQQWEWQQVLRWLDQGVRETWKIKTFQTEIKCTGNHLIRTDKGWIKAANITPKMKILSPEIDAAVKTALQDVESIEKLGVNHVYDIEVEHNHNFVANGLLVHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Spl DnaX mini-intein
publication title Structural, Dynamic, and Functional Characterization of a DnaX Mini-intein Derived from Spirulina platensis Provides Important Insights into Intein-Mediated Catalysis of Protein Splicing.
pubmed doi rcsb
source organism Arthrospira platensis c1
total genus 21
structure length 137
sequence length 137
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2020-06-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...