7CJ8A

Crystal structure of n-terminal his-tagged d-allulose 3-epimerase from methylomonas sp. in complex with d-allulose
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
287
structure length
287
Chain Sequence
b'SMAFPKRLEYGGHALVWSGDWSAAGARKAIAGAARAGYDYIEIALLDPWQIDVALTKDLLQEYNLRAHASLGLSAATDVTSTDPAIVAKGDELLRKATDVLYALGGSELCGVIYCALGKYPGPASRENRANSVAAMQRLADYAADKGINIDLEVVNRYETNIMNTGLEGLAFLDEVNRPNAFLHLDTYHMNIEENGMAKSVLAAGDRLGYVHIGESHRGYLGTGNVDFASFFAALKQIDYRGPITFESFSSEIVDPKLSNTLCVWRNLWHDSDDLAGKALEFIKQRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epimerase
publication title Crystal structure of a novel homodimeric L-ribulose 3-epimerase from Methylomonus sp.
pubmed doi rcsb
source organism Methylomonas sp. dh-1
molecule tags Isomerase
total genus 107
structure length 287
sequence length 287
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-07-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...