7CMPA

Pare in complex with amppnp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
374
structure length
374
Chain Sequence
RYNAADIEVLSGLDPVKRRPGMYTDTARPNHLAQEVIDNSVDEALAGHAKQIEVTLYKDGSCEVSDDGRGMPVDIHPEEKIPGVELILTRLHAGGKFNNRNYTFSGGLHGVGVSVVNALSTKVELFIKREGSEHRMEFRDGNAASKLEVVGTVGKKNTGTRLRFWADPKYFDTPKFNVRALRHLLRAKAVLCPGLTVKLHDEATGEQDSWYFENGLRDYLKGEMAEHEMLPADLFVGSLKKDTEIVDWAAGWVPEGELVQESYVNLIPTAQHGTHVNGLRSGLTDALREFCDFRNLLPRGVKLAPEDVWDRVTFVLSLKMTDPQFSGQTKERLSSRQAAGFIEGAAHDAFSLYLNQNVEIGEKIAQIAIDRASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of parE in complex with AMPPNP
rcsb
molecule keywords DNA topoisomerase 4 subunit B
molecule tags Antibiotic
source organism Xanthomonas oryzae pv. oryzae (strain kacc10331 / kxo85)
total genus 109
structure length 374
sequence length 374
chains with identical sequence B, C, D
ec nomenclature ec 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
pdb deposition date 2020-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...