7CUEE

Crystal structure of hid2 bound to human hemoglobin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
108
structure length
108
Chain Sequence
LSLITKLSQEDGAILFPEIDRYSDNKQIKALTQQITKVTVNGTVYKDLISDSVKDTNGWVSNMTGLHLGTKAFKDGENTIVISSKGFEDVTITVTKKDGQIHFVSAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Hemoglobin subunit alpha
publication title Structural basis for the recognition of human hemoglobin by the Shr protein from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
total genus 25
structure length 108
sequence length 108
chains with identical sequence F, H
ec nomenclature
pdb deposition date 2020-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07550 DUF1533 Protein of unknown function (DUF1533)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...