7CXZA

Crystal structure of pco2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
MHHHHHHSSGRENLYFQGHMQKLFDTCKKVFADGKSGTVPSQENIEMLRAVLDEIKPEDVGVNPKMSYFRSTVTGRSPLVTYLHIYACHRFSICIFCLPPSGVIPLHNHPEMTVFSKLLFGTMHIKSYDWVPDSPQPSSDTRLAKVKVDSDFTAPCDTSILYPADGGNMHCFTAKTACAVLDVIGPPYSDPAGRHCTYYFDYPFSSFSVDGVVVAEEEKEGYAWLKEREEKPEDLTVTALMYSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for cysteine oxidation by Plant Cysteine Oxidases from Arabidopsis thaliana.
pubmed doi rcsb
molecule tags Protein binding
source organism Arabidopsis thaliana
molecule keywords Plant cysteine oxidase 2
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2020-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07847 PCO_ADO PCO_ADO
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...