7CYVB

Crystal structure of fd20, a neutralizing single-chain variable fragment (scfv) in complex with sars-cov-2 spike receptor-binding domain (rbd)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
193
structure length
192
Chain Sequence
NLCPFGEVFNARFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords The heavy chain variable region of the scFv FD20,The light chain variable region of the scFv FD20
publication title Structural insight from a neutralizing human scFv in complex with RBD suggest a new site of vulnerability for SARS-CoV-2
rcsb
source organism Homo sapiens
total genus 29
structure length 192
sequence length 193
ec nomenclature
pdb deposition date 2020-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09408 bCoV_S1_RBD Betacoronavirus spike glycoprotein S1, receptor binding
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...