7D2YA

Complex of two rrm domains
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
TAYYLKDAGFHIRNIPKAWNDWNLFHVFQNFGKVSYCRVVGQSNDGQVQLGFVNMMSVADADEVRKNLNDGNLIGENFTLKVTDHKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for PICS-mediated piRNA biogenesis and cell division.
pubmed doi rcsb
molecule tags Protein binding
source organism Caenorhabditis elegans
molecule keywords Embryonic developmental protein tofu-6
total genus 17
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...