7D4ISK

Cryo-em structure of 90s small ribosomal precursors complex with the deah-box rna helicase dhr1 (state f)
Total Genus 44

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
174
Chain Sequence
SKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARKAE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (21-34)AH5 (101-106)TIV4 (117-120)EMPTYTIV2 (63-66)AH3 (67-83)TI1 (87-90)TIV3 (88-91)S2 (139-140)TIV7 (143-146)S1 (134-136)AH6 (109-116)3H1 (150-152)AH7 (122-131)TI2 (152-155)S3 (156-158)TIV10 (163-166)TIV1 (17-20)TVIII1 (15-18)AH4 (93-98)TIV9 (159-162)AH2 (39-61)TI3 (162-165)AH8 (171-179)Updating...
connected with : NaN
molecule tags Ribosome
publication title Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
rcsb
molecule keywords U3 snoRNA
total genus 44
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2020-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
SK PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.