7D5SSR

Cryo-em structure of 90s preribosome with inactive utp24 (state a2)
Total Genus 35

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (6-12)S2 (17-24)TIV1 (13-16)S4 (63-70)TIV4 (59-62)TI2 (57-60)EMPTYTI'1 (31-34)S3 (29-31)TIV2 (30-33)3H1 (36-38)TIV3 (41-44)AH1 (44-54)TVIa1 (39-42)AH3 (99-112)TI1 (56-59)AH2 (74-96)3H2 (114-116)Updating...
connected with : NaN
molecule tags Ribosome
publication title Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
rcsb
molecule keywords U3 snoRNA
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2020-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
SR PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.