7D63RA

Cryo-em structure of 90s preribosome with inactive utp24 (state c)
Total Genus 51

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
359
structure length
338
Chain Sequence
VLKSTSANDVSVYQVSGTNVLEYQNRVELIQDFEFSEASNKIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSWTKSVHLQNDRSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFLNPFKLDTEGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTTSFRNDGLTFACGTSNGYSYIYDLRTSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIWDRLDGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSIT
5010015020025030030025020015010050
01020304050Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (8-11)S2 (13-16)TI1 (18-21)TIV2 (15-18)S3 (61-64)S25 (296-301)3H1 (42-44)TIV4 (50-53)TIV3 (48-51)TIV8 (86-89)TIV6 (75-78)S4 (71-74)S7 (101-106)S5 (83-85)S9 (122-126)S6 (90-93)TI2 (85-88)S8 (114-118)TIV9 (108-113)S10 (133-136)TIV10 (118-121)S11 (141-146)TI3 (127-130)S12 (152-157)TI4 (189-192)S13 (161-166)TIV16 (208-211)TI5 (209-212)S14 (172-177)TVIII2 (166-169)TII1 (167-170)S15 (183-188)TIV14 (190-193)S16 (194-199)S17 (206-208)TIV17 (222-225)S18 (213-216)S20 (242-245)TIV23 (280-283)S21 (251-256)S22 (264-267)S23 (278-279)TIV22 (268-271)TI6 (293-296)S24 (288-292)S27 (317-323)TIV24 (302-305)TII3 (323-326)S26 (306-312)S28 (328-333)TIV5 (55-58)TIV13 (179-182)O1 (227-229)Updating...
connected with : NaN
molecule tags Ribosome
publication title Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
rcsb
molecule keywords U3 snoRNA
total genus 51
structure length 338
sequence length 359
ec nomenclature
pdb deposition date 2020-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
RA PF08159 NUC153 NUC153 domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.