7D63SJ

Cryo-em structure of 90s preribosome with inactive utp24 (state c)
Total Genus 26

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
195
structure length
166
Chain Sequence
GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGGNKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWFEAHYGQTLKIESSVESQFSAGRLYACISSRPGQSGRCDGYILEGEELAFYLRRL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (26-29)TI1 (6-9)TI2 (7-10)S1 (42-48)TIV3 (57-60)TIV2 (48-51)S2 (52-59)O1 (61-63)S4 (72-76)S3 (63-67)TI5 (67-70)TI6 (68-71)AH3 (154-162)S6 (100-105)S5 (80-83)TIV4 (84-87)TII1 (97-100)AH1 (88-93)AH2 (106-116)O2 (117-119)S7 (164-169)Updating...
connected with : NaN
molecule tags Ribosome
publication title Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
rcsb
molecule keywords U3 snoRNA
total genus 26
structure length 166
sequence length 195
ec nomenclature
pdb deposition date 2020-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
SJ PF01201 Ribosomal_S8e Ribosomal protein S8e
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...