7DCKA

Crystal structure of phosphodiesterase tw9814
Total Genus 82

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
246
Chain Sequence
SHHHHHHMASNTVKITISFDNYAYLEGFQTLWGFSCFVETDETTFLFDTGSNGRVLLQNMQQLDIDLKKAEALILSHPHWDHIGGVDSVLEVHPQMHLFVPNSLSKHLIRDLNAQTLGVTVINESPQQLLPSVYSTGVMGDIGEQSIVIDTEKGLVVITGCAHPGIEHIAARSIEMLQKPIYLLMGGFHLMYENTARISEVIETLDELGIQNVCPTHCSGDLAISMFKSHFGDRCLQGGIGRVITI

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TVIII1 (9-12)S2 (37-41)TVIII2 (12-15)S1 (16-21)AH1 (55-65)TII'1 (218-221)TIV1 (22-25)S3 (46-51)TIV3 (82-85)AH2 (87-94)TVIII3 (52-55)3H1 (69-71)TIV5 (95-98)S4 (74-76)S5 (99-103)EMPTYTI2 (81-84)TIV4 (83-86)AH3 (108-117)TI3 (103-106)S6 (121-124)S8 (135-141)S7 (129-132)S9 (146-153)TII1 (132-135)AH4 (168-179)TI5 (153-156)S11 (183-189)TI6 (164-167)TIV6 (161-164)TI7 (192-195)AH5 (197-210)AH6 (223-233)3H2 (234-236)S12 (214-218)TII2 (241-244)TI1 (42-45)S13 (244-247)TI4 (142-145)S10 (156-161)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Epsilonproteobacteria bacterium (ex lamellibrachia satsuma)
publication title Crystal structure of phosphodiesterase tw9814
rcsb
molecule keywords Lactamase_B domain-containing protein
total genus 82
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.