7DDEA

Cryo-em structure of the ape4 and nbr1 complex
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
542
structure length
525
Chain Sequence
MQLHGKMTATAKSCALDFLDFVNASPTPYHAVQNLAEHYMSHGFQYLSEKSDWQSKIEPGNSYFVTRNKSSIIAFSIGKKWKPGNGFSIIATHTDSPTLRLKPKSQKSAYGYLQVGVEKYGGGIWHTWFDRDLSLAGRVMVEEEDGRVIQYNVHIDRPLLRIPTLAIHLDPSANSSFSFNMETEFVPLIGLENELAKEETSDNGDKYHHPVLLSLLANEISKSLETTIDPSKIVDFELILGDAEKARLGGIHEEFVFSPRLDNLGMTFCASQALTKSLENNSLDNESCVRVVPSFDHEEIGSVSAQGAESTFLPAVLQRICELGKESSLFSISMVKSFLVSADMAHAMHPNYSSRYENSNTPFLNKGTVIKVNANQRYTTNSAGIVLLKKVAQLADVPIQSFVVRNDSPCGSTIGPKLAAMTGMRTLDLGNPMLSMHSCREMCGSKDFEYAVVLFSSFFQNFANLEEKIIIDEGFSVACNTCLKIIRNDSFHCTKCFDFDVCRDCYAKQAFLHPCPKPHFVLVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
pubmed doi rcsb
molecule keywords Aspartyl aminopeptidase 1,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein
molecule tags Hydrolase
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
total genus 127
structure length 525
sequence length 542
chains with identical sequence C, E, G, I, K, M, O, Q, S, V, X
ec nomenclature ec 3.4.11.21: Aspartyl aminopeptidase.
pdb deposition date 2020-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02127 Peptidase_M18 Aminopeptidase I zinc metalloprotease (M18)
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF00569 ZZ Zinc finger, ZZ type
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...