7DDXA

Crystal structure of kank1 s1179f mutant in complex wtih eif4a1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
246
structure length
246
Chain Sequence
ERYELSEKMLSACNLLKYNIKDPKALASKDMRICLNTLQHDWFRVSSQKSAVPAMVGDYIAAFEAVSPDVLRYIINMADGNGNTALHYSVFHSNFQIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMQVVEELFSCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nephrotic-syndrome-associated mutation of KANK2 induces pathologic binding competition with physiological interactor KIF21A.
pubmed doi rcsb
molecule tags Protein binding
source organism Mus musculus
molecule keywords KN motif and ankyrin repeat domains 1
total genus 88
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2020-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...