7DHFA

Vibrio vulnificus wzb in complex with benzylphosphonate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
146
structure length
146
Chain Sequence
GFNKILVVAVGNICRSPTGERVLQKLLPNKTVASAGIAAEKSRLIGKPADAMAIEVAKENCVDVENHQSQQLTSALCSQYDLILVMEKGHMEALTQIAPEARGKTMLFGQWIGQKDIPDPYRQSKEAFVHAYQLIDEAAQAWAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Wzb of Vibrio vulnificus represents a new group of low molecular weight protein tyrosine phosphatases with a unique insertion in the W-loop
rcsb
molecule keywords Protein-tyrosine-phosphatase
molecule tags Hydrolase
source organism Vibrio vulnificus
total genus 57
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2020-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...