7DIEA

Crystal structure of m. penetrans ferritin
Total Genus 75
20406080100120140160010203040506070
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
164
structure length
164
Chain Sequence
SVFNKDERIMDLVSKHYNVELCAANLYFHLATVSKALGYDNVAAFFVKMGSDKQSAHMSRLVKYMMKVDSILKINQISVPELVSFETIQEVLDAALKMESKVRESVKNVTEISLLAKDFETFERMQWFVKDSIEDLEEISDVWTYVHSPNVNLINIENIVGKKL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH3 (91-119)TI1 (4-7)AH2 (43-71)AH5 (156-165)AH4 (122-150)3H1 (79-81)EMPTYAH1 (10-40)TII1 (151-154)Updating...
connected with : NaN
molecule tags Metal binding protein
source organism Mycoplasma penetrans (strain hf-2)
publication title Ferritin with Atypical Ferroxidase Centers Takes B-Channels as the Pathway for Fe 2+ Uptake from Mycoplasma .
pubmed doi rcsb
molecule keywords Ferritin
total genus 75
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2020-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.