7DLBA

Crassostrea gigas ferritin mutant-d119k
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
169
structure length
169
Chain Sequence
ESQCRQNYHQESEAGINRQINMELYACYTYQSMAYYFDRDDVALPGFSKFFKNSSDEEREHAEKLMKYQNKRGGRVVLQDIKKPDRDEWGTGLDAMQVALQLEKTVNQSLLDLHKVAKSHQDAQMCDFLETHYLEEQVNAIKEISDHITQLKRVGSGLGEYEYDRRLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferritin
publication title Crassostrea gigas ferritin mutant-D119K
rcsb
source organism Crassostrea gigas
total genus 77
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 1.16.3.1: ferroxidase.
pdb deposition date 2020-11-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...