7DTJA

Crystal structure of the reca2 domain of rna helicase cgh-1 in c. elegans
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
173
structure length
173
Chain Sequence
MEELTLLGVTQYYAFVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYSCYYIHSKMAQNHRNRVFHDFRQGNCRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLYVADQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical insights into the recognition of RNA helicase CGH-1 by CAR-1 in C. elegans.
pubmed doi rcsb
molecule keywords ATP-dependent RNA helicase cgh-1
molecule tags Rna binding protein
source organism Caenorhabditis elegans
total genus 66
structure length 173
sequence length 173
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2021-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...