7DUPA

Apo structure of wild type bt4394, a gh20 family sulfoglycosidase
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
524
structure length
524
Chain Sequence
EIALTPQPAHLTVKDGRFEFGNQLKAKVTPYQGDSIRMVFESFKKELQEATGIKVSSTQKEAKARIILDLNPQLPAEAYKLNVSKKQVRIEASRPAGFYYALQTLKQLMPRNVMAGVATSDHSQWSLPSVEIEDAPRFEWRGFMLDEGRHFFGKDEIKRVIDMMAIYKMNRFHWHLTEDQGWRIEIKKYPKLTETGAWRNSKVLAYGDVKPDGERYGGFYTQKDIKEIVAYAKKKFIEIIPEIDIPGHSQAAVAAYPEFLACDPRDKHEVWLQQGISTDVINVANPKAMQFAKEVIDELTELFPFNYIHLGGDECPTRKWQKNDECKKLLSEIGSSNFRDLQIYFYKQLKDYIATKPADQQRQLIFWNEVLHGNTSILGNDITIMAWIGANAAAKQAAKQGMNTILSPQIPYYINRKQSKLPTEPMSQGHGTETVEAVYNYQPLKDVDAALQPYYKGVQANFWTEWVTEPSVLEYLMLPRLAAVAEAGWTPQEKRNYEDFKERIRKDAELYDLKGWNYGKHIMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-N-acetylhexosaminidase
publication title Mechanistic and Structural Insights into the Specificity and Biological Functions of Bacterial Sulfoglycosidases
doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 200
structure length 524
sequence length 524
ec nomenclature ec 3.2.1.52: beta-N-acetylhexosaminidase.
pdb deposition date 2021-01-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...