7DWDA

Crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
212
structure length
212
Chain Sequence
AEVKLYGFWPSPFSHRIIWALKLKGVEYEYIEEDLSNKSESLLKYNPVYKKTPVLVHGDKPIAESLVILEYIEETWPENPLLPKDPYERAMARFWIQYGVDTVAALRAFYLGSGEELEKAAKELSECLKILEEQGLGDKKFFGGESMNLVDISYGALGYWLAAVEEAKGVTVLKPSTLPRLHAWAKNLDELPVVKENIPASDKMLAYVTAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a glutathione S-transferase SbGSTU7 from Salix babylonica
rcsb
molecule keywords Glutathione S-transferase
molecule tags Transferase
source organism Salix babylonica
total genus 79
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2021-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...