7E40A

Mechanism of phosphate sensing and signaling revealed by rice spx1-phr2 complex structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
129
structure length
106
Chain Sequence
RMRWTPELHERFVDAMNLLGGSEKATPKGVMKLMKADNLTIYHVKSHMQKYRTARYRPGGNFDLTEALRMQLELQKRLHEQLEIQRSLQLRIEEQGKCLQMMLEQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of phosphate sensing and signaling revealed by rice SPX1-PHR2 complex structure.
pubmed doi rcsb
molecule tags Protein binding
source organism Oryza sativa subsp. japonica
molecule keywords Protein PHOSPHATE STARVATION RESPONSE 2
total genus 41
structure length 106
sequence length 129
chains with identical sequence C
ec nomenclature
pdb deposition date 2021-02-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...