7E53B

Crystal structure of sfgfp complexed with the nanobody nb2 at 2.2 angstron resolution
Total Genus 27

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
QVQLQESGGGSVQAGGSLRLSCAASGPTYSSYFMAWFRQAPGMEREGVAASSYDGSTTLYADSVKGRFTISQGNAKNTKFLLLNNLEPEDTAIYYCALRRRGWSNTSGWKQPGWYDYWGQGTQVTV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS10 (122-124)TII1 (13-16)S2 (18-25)TIV1 (75-78)TI1 (27-30)3H1 (88-90)S3 (33-39)TI2 (40-43)S4 (45-51)TI4 (61-64)S6 (68-72)TI3 (52-55)S5 (58-60)TI'1 (64-67)S7 (78-83)S8 (92-99)S9 (117-118)3H2 (112-114)TI6 (106-109)TI7 (108-111)S1 (3-7)TIV2 (83-86)TVIII1 (55-58)Updating...
connected with : NaN
molecule tags Fluorescent protein
source organism Aequorea victoria
publication title Structural insights into two distinct nanobodies recognizing the same epitope of green fluorescent protein.
pubmed doi rcsb
molecule keywords Green fluorescent protein
total genus 27
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2021-02-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.