7E6VA

The crystal structure of foot-and-mouth disease virus(fmdv) 2c protein 97-318aa
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
220
structure length
209
Chain Sequence
SRPEPVVVCLRGKSGQGKSFLANVLAQAISTHFTGAADSVWYCPPDPDHFDGYNQQAVVVMDDLGQNPDGKDFKYFAQMVSTTGFIPPMASLEDKGKPFNSKVIIATSNLYSGLNRRFHFDIDVSAKDGYKVNNKLDIIKALEDTHTNPVAMFQYDCALLNGMAVEMKRLQQDVFKPQPPILNVYQLVDEVIERVNLHEKVASQPIFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anti-picornaviral strategy based on the crystal structure of foot-and-mouth disease virus 2C protein.
pubmed doi rcsb
molecule tags Hydrolase
source organism Foot-and-mouth disease virus - type sat 2
molecule keywords Protein 2C
total genus 57
structure length 209
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.46: L-peptidase.
pdb deposition date 2021-02-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...