7E8EE

Cryoem structure of human kv4.2-dpp6s-kchip1 complex, transmembrane and intracellular region
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
181
structure length
177
Chain Sequence
PEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKTLDEFLESCQEDDNIMRSLQLFQNVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Kv channel-interacting protein 1
publication title Structural basis of gating modulation of Kv4 channel complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 177
sequence length 181
chains with identical sequence G
ec nomenclature
pdb deposition date 2021-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13499 EF-hand_7 EF-hand domain pair
E PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...