7EEBA

Structure of the catspermasome
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
LLGLQQMILSLTQSLGFETFIFIVVCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDFFIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAGTLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSLIYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a mammalian sperm cation channel complex.
pubmed doi rcsb
molecule keywords Enhanced green fluorescent protein,Cation channel sperm-associated protein 1
molecule tags Protein transport
source organism Human cytomegalovirus
total genus 91
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2021-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
A PF00520 Ion_trans Ion transport protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...