7EIZC

Coupling of n7-methyltransferase and 3'-5' exoribonuclease with sars-cov-2 polymerase reveals mechanisms for capping and proofreading
Total Genus 22

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
KMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (2-20)EMPTYAH2 (26-40)TI1 (21-24)TIV1 (22-25)TI2 (66-69)TIV3 (67-70)TIV4 (68-71)TI3 (69-72)AH3 (45-61)Updating...
connected with : NaN
molecule tags Viral protein/rna
source organism Severe acute respiratory syndrome coronavirus 2
publication title Coupling of N7-methyltransferase and 3'-5' exoribonuclease with SARS-CoV-2 polymerase reveals mechanisms for capping and proofreading
pubmed doi rcsb
molecule keywords RNA-directed RNA polymerase
total genus 22
structure length 72
sequence length 72
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2021-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08716 CoV_NSP7 Coronavirus replicase NSP7
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.