7EJ2A

Human voltage-gated potassium channel kv1.3 h451n mutant
Total Genus 80
5010015020025030001020304050607080
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTII'1 (42-45)S1 (39-41)TIV1 (37-40)TIV2 (41-44)S2 (48-50)S4 (83-87)AH4 (166-179)S3 (52-54)TVIII1 (50-53)TIV3 (56-59)3H2 (110-112)PH1 (59-63)AH1 (66-78)AH2 (94-106)TI1 (125-128)S5 (114-119)TIV7 (143-146)TI2 (145-148)TVIII2 (152-155)TIV6 (126-129)S6 (154-157)TIV9 (187-190)TI4 (201-204)TI5 (203-206)S10 (319-322)S7 (184-188)AH5 (192-201)AH8 (280-299)TIV10 (202-205)S8 (212-216)AH6 (223-236)TI6 (218-221)TIV11 (219-222)TI7 (244-247)TI8 (249-252)3H3 (247-249)TI9 (250-253)TI10 (253-256)TI11 (255-258)TIV12 (260-263)TI12 (263-266)TI13 (264-267)AH7 (271-278)TII1 (267-270)TIV13 (314-317)AH3 (133-143)TI3 (161-164)AH9 (303-312)TVIII3 (315-318)S9 (241-243)Updating...
connected with : NaN
molecule tags Membrane protein
source organism Homo sapiens
publication title Structures of wild-type and H451N mutant human lymphocyte potassium channel K V 1.3.
pubmed doi rcsb
molecule keywords Voltage-gated potassium channel subunit beta-2
total genus 80
structure length 326
sequence length 326
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.-:
pdb deposition date 2021-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.