7EJZH

Complex structure of antibody bd-503 and rbd-s477n of covid-19
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
219
structure length
215
Chain Sequence
EVQLVESGGGLIQPGGSLRLSCAASGLIVSSNYMSWVRQAPGKGLEWVSVLYAGGSTDYAGSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDAAVYGIDVWGQGTTVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based analyses of neutralization antibodies interacting with naturally occurring SARS-CoV-2 RBD variants.
pubmed doi rcsb
molecule tags Viral protein/immune system
source organism Severe acute respiratory syndrome coronavirus 2
molecule keywords Spike protein S1
total genus 32
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2021-04-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...