7EKEB

Structure of sars-cov-2 spike receptor-binding domain f486l mutation complexed with human ace2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
195
structure length
195
Chain Sequence
TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGLNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/viral protein
molecule keywords Angiotensin-converting enzyme 2
publication title Molecular insights into receptor binding of recent emerging SARS-CoV-2 variants.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2021-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09408 bCoV_S1_RBD Betacoronavirus spike glycoprotein S1, receptor binding
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...