7ENAd

Tfiid-based pic-mediator holo-complex in pre-assembled state (pre-hpic-med)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
158
Chain Sequence
TRERLLSALEDLEVLSRELIEMLAISRENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the human Mediator and Mediator-bound preinitiation complex.
pubmed doi rcsb
molecule tags Transcription
source organism Homo sapiens
molecule keywords CDK-activating kinase assembly factor MAT1
total genus 57
structure length 158
sequence length 167
ec nomenclature
pdb deposition date 2021-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF10018 Med4 Vitamin-D-receptor interacting Mediator subunit 4
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...