7ERVA

Crystal structure of l-histidine decarboxylase (c57s/c101v/c282v mutant) from photobacterium phosphoreum
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
374
structure length
373
Chain Sequence
MTLSIENQNKLDEFWAYCVKNQYFNIGYPESADFDYTILERFMRFSINNCGDWAEYSNYLLNSFDFEKEVMEYFADLFKIPFEDSWGYVTNGGTESNMFGVYLGRELFPDGTLYYSKDTHYSVAKIVKLLRIKSQLVDSLPNGEIDYDDLISKIKQDDEKHPIIFANIGTTVRGAIDDISKIQAMIGELGIKREDYYIHADAALSGMILPFVDEPQGFNFADGIDSIGVSGHMIGSPIPCGIVVAKKRNVDAISVEIDYISAHDKTITGSRNGHTPLMMWVAVKSHSHADFKRRINRSLDLAQHAVQRLQTAGINAWCNKNSITVVFPCPSEAVWKKHCLATSGGQAHLITTAHHLDASKVDALIDDVIKDAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the enhanced thermostability of cysteine substitution mutants of L-histidine decarboxylase from Photobacterium phosphoreum.
pubmed doi rcsb
molecule tags Lyase
source organism Photobacterium phosphoreum
molecule keywords Histidine decarboxylase
total genus 132
structure length 373
sequence length 374
ec nomenclature ec 4.1.1.22: histidine decarboxylase.
pdb deposition date 2021-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...