7ESZB

Crystal structure of the complex formed by wolbachia cytoplasmic incompatibility factors cina and cinb with mn2+ from wpip
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
414
structure length
408
Chain Sequence
SGLDHNYNKILDILKGAIKGDDNQVKARKHLRVERWLRAYIQLIEDFDEEKLIFFSDIFSDNSCWDGIKLKNKAVGERLTEEKNKNGKENPLDLADRYYLACKYCLEDKIPGLFEQVFMRFKRSADDDLRRELLENIEETSPIEAFWSFLIDKQIGKLNEYKSVEGLQKSIQINSNKNWEEGIEFFYNKLHNDSSISSQDKDDLLIEAALSAVKGYKEVDTIEFCLSKMDDEQKKKLLDRDYKENTYYAVLNVLVGQYYFDSFMELSRLCSQIECERYTTFLSSLSDQVLKNPDLSEETKKCMMNVWERIIKLKTQDRGEQSISSIFVDYSVTYTIANLIVDPSRQGVSKEEILGKILKHVKEMSGEEMIKVKDSVLSKIQLFHGGKKLQLGEQVFSKLAQEASKESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into the complexes formed by Wolbachia cytoplasmic incompatibility factors.
pubmed doi rcsb
molecule tags Protein binding
source organism Wolbachia pipientis subsp. culex pipiens (strain wpip)
molecule keywords BACTERIA FACTOR B
total genus 158
structure length 408
sequence length 414
chains with identical sequence D
ec nomenclature
pdb deposition date 2021-05-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...