7EX3A

Crystal structure of ebinur lake virus cap snatching endonuclease in complex with inhibitor 3
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
DPMYEQFLQRIQAVRTATVAKDISADILEARHDYFGRELCRALDIEYRNNVLLDEIILDVYPGVNLMEYNVPHVTPDNYIWTGDMLLILDYKVSVGHDSTEVTYKKYTTLILPVMQEIGINTEICIIRANPVTNQISIVGEQFKRLFPTIPVELNFARFFELRKMLLDKFADDEEFLMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Basis for Development of Diketo Acid Inhibitors Targeting the Cap-Snatching Endonuclease of the Ebinur Lake Virus (Order: Bunyavirales ).
pubmed doi rcsb
molecule tags Hydrolase
source organism Abbey lake orthobunyavirus
molecule keywords Replicase
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2021-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...