7EXKA

An aa9 lpmo of ceriporiopsis subvermispora
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
HYTLPDLIANGTVAADWQFVRETANHYTNGPVTDVTDEAIRCYELDYSATPGETNIATVSAGSTVGMQGNGAFYHPGYFSAYLSQASPAANSPDAGTASTWFKIWEDPPVFENGALVFPSQSIDQVTFTIPKNLPSGQYLLRTEQIALHVASTFGGAQFYIGCAQLNVVDGGSGTPGPTVAFPGAYTGNEPGILINIYDLPAGYTGYQSPGPAVWQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterizations of Lytic Polysaccharide Monooxygenase, Which Cooperates Synergistically with Cellulases, from Ceriporiopsis subvermispora.
doi rcsb
molecule tags Oxidoreductase
source organism Ceriporiopsis subvermispora (strain b)
molecule keywords Glycoside hydrolase family 61 protein
total genus 47
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.4: cellulase.
pdb deposition date 2021-05-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...